Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR159W  from Saccharomyces cerevisiae S288C
>YLR159W|YLR159W YLR159W SGDID:S000004149, Chr XII from 485345-485689, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; YLR156W, YLR159W, and YLR161W are three identical open reading frames encoded near the ribosomal DNA region of chromosome 12" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCM
RPANQEIYPLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT