Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR159C-A  from Saccharomyces cerevisiae S288C
>YLR159C-A|YLR159C-A YLR159C-A SGDID:S000028566, Chr XII from 485842-485711, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-5" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW