Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR157W-E  from Saccharomyces cerevisiae S288C
>YLR157W-E|YLR157W-E YLR157W-E SGDID:S000028678, Chr XII from 481873-482037, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching; partially overlaps a Ty1 element" ORGANISM: Saccharomyces cerevisiae S288C (54 aa)
MIVDFYSNTLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT