Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR157W-D  from Saccharomyces cerevisiae S288C
>YLR157W-D|YLR157W-D YLR157W-D SGDID:S000028677, Chr XII from 475764-475976, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (70 aa)
MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCM
RPANQEIYPL