Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR157C-C  from Saccharomyces cerevisiae S288C
>YLR157C-C|YLR157C-C YLR157C-C SGDID:S000028565, Chr XII from 482190-482059, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-4" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW