Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR156W  from Saccharomyces cerevisiae S288C
>YLR156W|YLR156W YLR156W SGDID:S000004146, Chr XII from 472113-472457, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; exhibits a two-hybrid interaction with Jsn1p in a large-scale analysis" ORGANISM: Saccharomyces cerevisiae S288C (114 aa)
MKFQYALAKEQLGSNSRSGVKKLISKHHWLPEYYFSDLSFSVVQQWDSRAIEKTTIISCM
RPANQEIYPLRHCETLRSQPCSLFSSLYARSFQSSCTLHVAEPSPGFHMYGCHT