Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR156C-A  from Saccharomyces cerevisiae S288C
>YLR156C-A|YLR156C-A YLR156C-A SGDID:S000028564, Chr XII from 472610-472479, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-3" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW