Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR154W-C  from Saccharomyces cerevisiae S288C
>YLR154W-C|YLR154W-C TAR1 SGDID:S000028422, Chr XII from 454696-455070, Genome Release 64-1-1, Verified ORF, "Mitochondrial protein potentially involved in regulation of respiratory metabolism; interacts genetically with RPO41 and physically with Coq5p; encoded within the 25S rRNA gene on the opposite strand" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MRDSPTHKEQRAQNTMSDQMPFPFNNFTYFFTLFSKFFSSFHHCTCSLSVSRQYLALDGI
YHPLRAAFPNNSTLRRHFTKNRTPRHTGFSPSMTSCSKEHRQGTAPKLPSPNYNSGTEGT
RFQI