Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR154C-H  from Saccharomyces cerevisiae S288C
>YLR154C-H|YLR154C-H YLR154C-H SGDID:S000028562, Chr XII from 468958-468827, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF partially overlaps RND5-2" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW