Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR154C-G  from Saccharomyces cerevisiae S288C
>YLR154C-G|YLR154C-G YLR154C-G SGDID:S000028561, Chr XII from 462671-462522, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function identified by fungal homology comparisons and RT-PCR; this ORF is contained within RDN25-2 and RDN37-2" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MWRRRREPWEELSFLLNSLSPRNWFIRRWGLMAGRGQHLCWLRCACDGP