>YLR147C|YLR147C SMD3 SGDID:S000004137, Chr XII from 434463-434158, Genome Release 64-1-1, reverse complement, Verified ORF, "Core Sm protein Sm D3; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Sme1p, Smx3p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm D3" ORGANISM: Saccharomyces cerevisiae S288C (101 aa)
MTMNGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMD
QIFVRGSQIKFIVVPDLLKNAPLFKKNSSRPMPPIRGPKRR