Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR145W  from Saccharomyces cerevisiae S288C
>YLR145W|YLR145W RMP1 SGDID:S000004135, Chr XII from 432168-432773, Genome Release 64-1-1, Verified ORF, "Subunit of RNase MRP, which processes pre-rRNA and has a role in cell cycle-regulated degradation of daughter cell-specific mRNAs; unlike most subunits, not shared between RNase MRP and nuclear RNase P" ORGANISM: Saccharomyces cerevisiae S288C (201 aa)
MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAK
RLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLW
EINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTE
NCKKKKKRKKKNKSAIDGIFG