Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR125W  from Saccharomyces cerevisiae S288C
>YLR125W|YLR125W YLR125W SGDID:S000004115, Chr XII from 393484-393894, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; mutant has decreased Ty3 transposition; YLR125W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (136 aa)
MGEILELTNKNFMSHLKKDITSQESLKSRIEDKNGDVASPKEDNYPLLNETAAWPDGVIT
SEEGCSSSGEKENSGLCSEESSEEDPEEAEEESARAFGELVAVLRDKDIPLNVLDEPQMK
DWLEKYTGVYRSSWHG