Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR118C  from Saccharomyces cerevisiae S288C
>YLR118C|YLR118C YLR118C SGDID:S000004108, Chr XII from 385408-384725, Genome Release 64-1-1, reverse complement, Verified ORF, "Acyl-protein thioesterase responsible for depalmitoylation of Gpa1p; green fluorescent protein (GFP)-fusion protein localizes to both the cytoplasm and nucleus and is induced in response to the DNA-damaging agent MMS" ORGANISM: Saccharomyces cerevisiae S288C (227 aa)
MNGLRVAAKIQPARQTIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNFVFPNAPELHV
TANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTVKQEIDKGIKPEQIIIGGFSQ
GAALALATSVTLPWKIGGIVALSGFCSIPGILKQHKNGINVKTPIFHGHGDMDPVVPIGL
GIKAKQFYQDSCEIQNYEFKVYKGMAHSTVPDELEDLASFIKKSLSS