Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR110C  from Saccharomyces cerevisiae S288C
>YLR110C|YLR110C CCW12 SGDID:S000004100, Chr XII from 370098-369697, Genome Release 64-1-1, reverse complement, Verified ORF, "Cell wall mannoprotein with a role in maintenance of newly synthesized areas of cell wall; localizes to periphery of small buds, septum region of larger buds, and shmoo tip" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MQFSTVASIAAVAAVASAAANVTTATVSQESTTLVTITSCEDHVCSETVSPALVSTATVT
VDDVITQYTTWCPLTTEAPKNGTSTAAPVTSTEAPKNTTSAAPTHSVTSYTGAAAKALPA
AGALLAGAAALLL