Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR075W  from Saccharomyces cerevisiae S288C
>YLR075W|YLR075W RPL10 SGDID:S000004065, Chr XII from 282927-283592, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" ORGANISM: Saccharomyces cerevisiae S288C (221 aa)
MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHLVSNELEQL
SSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWG
KPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQKIILSKKWGFTNLDRPE
YLKKREAGEVKDDGAFVKFLSKKGSLENNIREFPEYFAAQA