Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR074C  from Saccharomyces cerevisiae S288C
>YLR074C|YLR074C BUD20 SGDID:S000004064, Chr XII from 282456-281956, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern" ORGANISM: Saccharomyces cerevisiae S288C (166 aa)
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHYCIHCAKYMET
AIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFLNRVQEITQSVGPEKESNE
ALLKEHLDSTLANVKTTEPTLPWAAADAEANTAAVTEAESTASAST