Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR061W  from Saccharomyces cerevisiae S288C
>YLR061W|YLR061W RPL22A SGDID:S000004051, Chr XII from 263194-263205,263595-263948, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (121 aa)
MAPNTSRKQKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQVTPEEDEEEDE
E