Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR050C  from Saccharomyces cerevisiae S288C
>YLR050C|YLR050C YLR050C SGDID:S000004040, Chr XII from 246072-245587, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum; YLR050C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (161 aa)
MKLGHREQQFYLWYFIVHIPITIFIDSSVVIPAKWQLGIAQKVVSDHIAKQHDFLLSEKP
EWLYWFVVLELVLQLPLFVYFVNKFWNSSELQVNTNSRLKKWLRIYGWNASLTTLICIVV
IFKRGYIPYDVLKTSLSMTQKCQLASVYLPTFLIPLRLCFV