Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR043C  from Saccharomyces cerevisiae S288C
>YLR043C|YLR043C TRX1 SGDID:S000004033, Chr XII from 232013-231702, Genome Release 64-1-1, reverse complement, Verified ORF, "Cytoplasmic thioredoxin isoenzyme of the thioredoxin system which protects cells against oxidative and reductive stress, forms LMA1 complex with Pbi2p, acts as a cofactor for Tsa1p, required for ER-Golgi transport and vacuole inheritance" ORGANISM: Saccharomyces cerevisiae S288C (103 aa)
MVTQFKTASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDEL
GDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA