>YLR038C|YLR038C COX12 SGDID:S000004028, Chr XII from 225172-224921, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit VIb of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; required for assembly of cytochrome c oxidase but not required for activity after assembly; phosphorylated" ORGANISM: Saccharomyces cerevisiae S288C (83 aa)
MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCP
LDWIEKWDDQREKGIFAGDINSD