Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR037C  from Saccharomyces cerevisiae S288C
>YLR037C|YLR037C PAU23 SGDID:S000004027, Chr XII from 223059-222685, Genome Release 64-1-1, reverse complement, Verified ORF, "Cell wall mannoprotein with similarity to Tir1p, Tir2p, Tir3p, and Tir4p; member of the seripauperin multigene family encoded mainly in subtelomeric regions; expressed under anaerobic conditions, completely repressed during aerobic growth" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MVKLTSIVAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAH
PTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSKDGIYT
AVPN