Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR021W  from Saccharomyces cerevisiae S288C
>YLR021W|YLR021W IRC25 SGDID:S000004011, Chr XII from 183623-184162, Genome Release 64-1-1, Verified ORF, "Component of a heterodimeric Poc4p-Irc25p chaperone involved in assembly of alpha subunits into the 20S proteasome; may regulate formation of proteasome isoforms with alternative subunits under different conditions" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MISYEFQTHLPKGKDSSLNASSENKELYVQATHFNNTILLQIRLNGEMDSTYEVSSKGLN
PILDINVPLAGNLGNTGGDYDDEEEEFVRDHLSDYQVVTKLGDSADPKVPVVCVQIAELY
RRVILPEVSGTMAQDNMQFSLLISMSSKIWRATKEQSADDNDFGKLVFVLKCIKDMYAK