Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YLR012C  from Saccharomyces cerevisiae S288C
>YLR012C|YLR012C YLR012C SGDID:S000004002, Chr XII from 170281-169982, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; YLR012C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MKTVYYKEITYQQYLQLQPEQQEKYLALCQKDFEQETERIAFDRQGGVPGIARKFAQEEV
AWFDRVTTWSYMNAYIPSYRRRRNLLKIDMLKMSNAEEY