Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR011W  from Saccharomyces cerevisiae S288C
>YLR011W|YLR011W LOT6 SGDID:S000004001, Chr XII from 169103-169678, Genome Release 64-1-1, Verified ORF, "FMN-dependent NAD(P)H:quinone reductase, may be involved in quinone detoxification; expression elevated at low temperature; sequesters the Cin5p transcription factor in the cytoplasm in complex with the proteasome under reducing conditions" ORGANISM: Saccharomyces cerevisiae S288C (191 aa)
MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELI
PAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPAL
VVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQL
LASCIETTRNK