Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLR008C  from Saccharomyces cerevisiae S288C
>YLR008C|YLR008C PAM18 SGDID:S000003998, Chr XII from 166083-165577, Genome Release 64-1-1, reverse complement, Verified ORF, "Constituent of the import motor (PAM complex) component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); essential J-protein cochaperone that stimulates Ssc1p ATPase activity to drive import; inhibited by Pam16p" ORGANISM: Saccharomyces cerevisiae S288C (168 aa)
MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY
MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLT
ENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK