Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL064C  from Saccharomyces cerevisiae S288C
>YLL064C|YLL064C PAU18 SGDID:S000003987, Chr XII from 13445-13083, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; identical to Pau6p" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTE
TYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISKALSKDGIYTIAN