Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL052C  from Saccharomyces cerevisiae S288C
>YLL052C|YLL052C AQY2 SGDID:S000003975, Chr XII from 36361-35912, Genome Release 64-1-1, reverse complement, Verified ORF, "Water channel that mediates the transport of water across cell membranes, only expressed in proliferating cells, controlled by osmotic signals, may be involved in freeze tolerance; disrupted by a stop codon in many S. cerevisiae strains" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MSNESNDLEKNISHLDPTGVDNAYIPPEQPETKHSRFNIDRDTLRNHFIAAVGEFCGTFM
FLWCAYVICNVANHDVALTTEPEGSHPGQLIMIALGFGFSVMFSIWCFWWGFEPSRFSLF
VFGQSHLTSQMCSDVVSSDHCWDGCWWCR