Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL050C  from Saccharomyces cerevisiae S288C
>YLL050C|YLL050C COF1 SGDID:S000003973, Chr XII from 40221-39804,40414-40401, Genome Release 64-1-1, reverse complement, Verified ORF, "Cofilin, promotes actin filament depolarization in a pH-dependent manner; binds both actin monomers and filaments and severs filaments; thought to be regulated by phosphorylation at SER4; ubiquitous and essential in eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSRSGVAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLEKLPEN
DCLYAIYDFEYEINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQ
GTDFSEVSYDSVLERVSRGAGSH