Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL049W  from Saccharomyces cerevisiae S288C
>YLL049W|YLL049W LDB18 SGDID:S000003972, Chr XII from 40666-41205, Genome Release 64-1-1, Verified ORF, "Component of the dynactin complex, which is required for dynein activity; null mutant exhibits defects in nuclear migration and spindle orientation and has reduced affinity for alcian blue dye; has homology to mammalian dynactin subunit p24" ORGANISM: Saccharomyces cerevisiae S288C (179 aa)
MPGLKLVEALEYRCDRLERLIGAGYSANSDVSVQLDELYNQLHRLYFQGLKYSQDLLQLF
NTFMAEDIENVGAPDDICIFASCFDDIYTLYSAFDELNSQYMEFCQISKSSLDQISFKDA
NIETKQLKKLPELVDNCNIMILRSIAILNRFIDWNIEVNGFFQFQKKRLLNLQKVIYST