Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL025W  from Saccharomyces cerevisiae S288C
>YLL025W|YLL025W PAU17 SGDID:S000003948, Chr XII from 94747-95121, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions; YLL025W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (124 aa)
MVKLTSIAAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAH
PTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSADGIYT
AVPN