Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL018C-A  from Saccharomyces cerevisiae S288C
>YLL018C-A|YLL018C-A COX19 SGDID:S000007245, Chr XII from 108972-108676, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein required for cytochrome c oxidase assembly, located in the cytosol and mitochondrial intermembrane space; putative copper metallochaperone that delivers copper to cytochrome c oxidase; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (98 aa)
MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYL
RCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK