Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL014W  from Saccharomyces cerevisiae S288C
>YLL014W|YLL014W EMC6 SGDID:S000003937, Chr XII from 121322-121648, Genome Release 64-1-1, Verified ORF, "Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response" ORGANISM: Saccharomyces cerevisiae S288C (108 aa)
MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLI
NVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG