Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YLL009C  from Saccharomyces cerevisiae S288C
>YLL009C|YLL009C COX17 SGDID:S000003932, Chr XII from 131414-131205, Genome Release 64-1-1, reverse complement, Verified ORF, "Copper metallochaperone that transfers copper to Sco1p and Cox11p for eventual delivery to cytochrome c oxidase; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (69 aa)
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKG
YGFEVPSAN