Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR095W-A  from Saccharomyces cerevisiae S288C
>YKR095W-A|YKR095W-A PCC1 SGDID:S000028512, Chr XI from 625864-625901,625977-626205, Genome Release 64-1-1, Verified ORF, "Component of the EKC/KEOPS protein complex with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS complex is required for t6A tRNA modification and may have roles in telomere maintenance and transcription" ORGANISM: Saccharomyces cerevisiae S288C (88 aa)
MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS
IDDRVLRVGVSSIIDSIKTIVEAMDVLS