Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR083C  from Saccharomyces cerevisiae S288C
>YKR083C|YKR083C DAD2 SGDID:S000001791, Chr XI from 596822-596421, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segregation; is transferred to the kinetochore prior to mitosis" ORGANISM: Saccharomyces cerevisiae S288C (133 aa)
MDSIDEQIAIKRKELQSLQKITSLTDGLKIQLTELNEQIKEMGMNADSVAQLMNNWDSII
NNISQASLGLLQYAEGDYEIGPWKDSKKKESEQSNETGLEAQENDKNDEDNDEDEDLVPL
PETMVRIRVDGNE