Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR074W  from Saccharomyces cerevisiae S288C
>YKR074W|YKR074W AIM29 SGDID:S000001782, Chr XI from 579209-579676, Genome Release 64-1-1, Verified ORF, "Putative protein of unknown function; epitope-tagged protein localizes to the cytoplasm; YKR074W is not an essential gene; null mutant displays elevated frequency of mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (155 aa)
MNSTKRLKMSTTFHDYDLEEPLTSNARPLKNSVITIRVIKSFPYRNVKNIVLHDYDLADK
TAKDLFNDVLNKIQNEGSFRPFRNVKFDTLKIYTHAHGSKTVNLVINFDHDDDWTLDIEN
DKKKLFEYGIENETEISLFNKEDYLRFKENPEEKW