Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR065C  from Saccharomyces cerevisiae S288C
>YKR065C|YKR065C PAM17 SGDID:S000001773, Chr XI from 565892-565299, Genome Release 64-1-1, reverse complement, Verified ORF, "Constituent of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); proposed alternatively to be a component of the import motor (PAM complex) or to interact with and modulate the core TIM23 complex" ORGANISM: Saccharomyces cerevisiae S288C (197 aa)
MFTSAIRLSSQRLFASQPSVTAAALRSTATTLPLRSYSQPASLQDSSILTWSDFFKLRKQ
QRRINVGSSLFTALLGCNVSWAYLSTMEIDPTQMLFGFDPLTVISAGIIASGALGYLLGP
IVGSQVFKLSHNQQLAQFNNKNKEFLKHIINNRVDASSQSFSNPVPDYYGEKIGSLKEYK
QWLRDCHAYAKKAKEFL