Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR057W  from Saccharomyces cerevisiae S288C
>YKR057W|YKR057W RPS21A SGDID:S000001765, Chr XI from 551657-551680,552003-552242, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps21Bp and has similarity to rat S21 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (87 aa)
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEYVTYALSGYVR
SRGESDDSLNRLAQNDGLLKNVWSYSR