Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR043C  from Saccharomyces cerevisiae S288C
>YKR043C|YKR043C SHB17 SGDID:S000001751, Chr XI from 521712-520897, Genome Release 64-1-1, reverse complement, Verified ORF, "Sedoheptulose bisphosphatase involved in riboneogenesis; dephosphorylates sedoheptulose 1,7-bisphosphate, which is converted via the nonoxidative pentose phosphate pathway to ribose-5-phosphate; facilitates the conversion of glycolytic intermediates to pentose phosphate units; also has fructose 1,6-bisphosphatase activity but this is probably not biologically relevant, since deletion does not affect FBP levels; GFP-fusion protein localizes to the cytoplasm and nucleus" ORGANISM: Saccharomyces cerevisiae S288C (271 aa)
MPSLTPRCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNIT
YIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSR
GLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHAL
RYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVL
SYAHHNIDEPALELAGPFVSPPEEESQHGDV