Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR020W  from Saccharomyces cerevisiae S288C
>YKR020W|YKR020W VPS51 SGDID:S000001728, Chr XI from 478338-478832, Genome Release 64-1-1, Verified ORF, "Component of the GARP (Golgi-associated retrograde protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for the recycling of proteins from endosomes to the late Golgi; links the (VFT/GARP) complex to the SNARE Tlg1p" ORGANISM: Saccharomyces cerevisiae S288C (164 aa)
MAEQISHKKSLRVSSLNKDRRLLLREFYNLENEPNKGRQEARIGEKASEAHSGEEQVTDV
NIDTEANTEKPVKDDELSATEEDLKEGSEDAEEEIKNLPFKRLVQIHNKLLGKETETNNS
IKNTIYENYYDLIKVNDLLKEITNANEDQINKLKQTVESLIKEL