Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKR007W  from Saccharomyces cerevisiae S288C
>YKR007W|YKR007W MEH1 SGDID:S000001715, Chr XI from 451434-451988, Genome Release 64-1-1, Verified ORF, "Component of the EGO complex, which is involved in the regulation of microautophagy, and of the GSE complex, which is required for proper sorting of amino acid permease Gap1p; loss results in a defect in vacuolar acidification" ORGANISM: Saccharomyces cerevisiae S288C (184 aa)
MGAVLSCCRNHSGEENEALLREQQAGYGSQGNANDEYDAEQMRLKEHEHEQKLLAREQEL
RDIVANTNDKLIDISMINNSGIVIQGTDLQEALDKRQQEEGGDSREDERSAGDDNLSGHS
VPSSGSAQATTHQTAPRTNTFTLLTSPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPL
TVPF