Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL214C  from Saccharomyces cerevisiae S288C
>YKL214C|YKL214C YRA2 SGDID:S000001697, Chr XI from 31693-31082, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the REF (RNA and export factor binding proteins) family; when overexpressed, can substitute for the function of Yra1p in export of poly(A)+ mRNA from the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (203 aa)
MDKAFDEIIGNSHTDSSSNHKVTRYRRRDLRNELGPRLGFAPSDAASRSKDRLYREREEP
PLPKRIRISKIPLDVSDYTLDDMIKEFGSPIFSKIFDNKEDRTCIYEFEDPEVLEKIVER
YNGHELHNAKIEVEIYQPQRKHSRMNAHNRRKQTAQEHGRGRPGSHYRQKPNRVSKKNKG
REKNNTPTSVEALDAELDAYMKG