Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL196C  from Saccharomyces cerevisiae S288C
>YKL196C|YKL196C YKT6 SGDID:S000001679, Chr XI from 75534-74932, Genome Release 64-1-1, reverse complement, Verified ORF, "Vesicle membrane protein (v-SNARE) with acyltransferase activity; involved in trafficking to and within the Golgi, endocytic trafficking to the vacuole, and vacuolar fusion; membrane localization due to prenylation at the carboxy-terminus" ORGANISM: Saccharomyces cerevisiae S288C (200 aa)
MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGQRQSIE
EGNYIGHVYARSEGICGVLITDKEYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDAL
KMKQLDTYISKYQDPSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLT
ASSKMFYKQAKKSNSCCIIM