Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL190W  from Saccharomyces cerevisiae S288C
>YKL190W|YKL190W CNB1 SGDID:S000001673, Chr XI from 82947-82998,83075-83550, Genome Release 64-1-1, Verified ORF, "Calcineurin B; the regulatory subunit of calcineurin, a Ca++/calmodulin-regulated type 2B protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is encoded by CNA1 and/or CMP1" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MGAAPSKIVDGLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVLK
IMVGSNLDDEQLQQIVDRTIVENDSDGDGRLSFEEFKNAIETTEVAKSLTLQYDV