Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL167C  from Saccharomyces cerevisiae S288C
>YKL167C|YKL167C MRP49 SGDID:S000001650, Chr XI from 134134-133721, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit, not essential for mitochondrial translation" ORGANISM: Saccharomyces cerevisiae S288C (137 aa)
MSKVAQQLKFLNKISATTRLPQILVDPKKYSGLRLTFQTKNHNGHMGARVFWHNYLPTLQ
FYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEGSVVETIDMRNKMHEDIMKDLLDKIEHV
PLPENEIIRVGPQESII