Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL160W  from Saccharomyces cerevisiae S288C
>YKL160W|YKL160W ELF1 SGDID:S000001643, Chr XI from 153269-153706, Genome Release 64-1-1, Verified ORF, "Transcription elongation factor that contains a conserved zinc finger domain; implicated in the maintenance of proper chromatin structure in actively transcribed regions; deletion inhibits Brome mosaic virus (BMV) gene expression" ORGANISM: Saccharomyces cerevisiae S288C (145 aa)
MGKRKKSTRKPTKRLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRI
NSLSQPVDVYSDWFDAVEEVNSGRGSDTDDGDEGSDSDYESDSEQDAKTQNDGEIDSDEE
EVDSDEERIGQVKRGRGALVDSDDE