Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL156W  from Saccharomyces cerevisiae S288C
>YKL156W|YKL156W RPS27A SGDID:S000001639, Chr XI from 158613-158615,158967-159212, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps27Bp and has similarity to rat S27 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (82 aa)
MVLVQDLLHPTAASEARKHKLKTLVQGPRSYFLDVKCPGCLNITTVFSHAQTAVTCESCS
TILCTPTGGKAKLSEGTSFRRK