Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL142W  from Saccharomyces cerevisiae S288C
>YKL142W|YKL142W MRP8 SGDID:S000001625, Chr XI from 178515-179174, Genome Release 64-1-1, Verified ORF, "Protein of unknown function; undergoes sumoylation; transcription induced under cell wall stress; protein levels are reduced under anaerobic conditions; originally thought to be a mitochondrial ribosomal protein based on sequence analysis" ORGANISM: Saccharomyces cerevisiae S288C (219 aa)
MSNEIELLQKQVSELQDLVKKQSLIISKTGERVLELQLDKQKHDVTDFDSKFSKSISKKS
GSATQFDATDFATNEDLVELVKELQGELNFIEERSIRRLVNSLKKDDDDVIAPLPNADGD
IPAISDGVFPKSLKEFKDIPDLKLVRLAKFYERLPPTLKEQEDFENFLEGKVEAFHINET
TDEEISKELEKFSKDELDDAFNDVARYLGLSLRRGTEIW