Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YKL138C-A  from Saccharomyces cerevisiae S288C
>YKL138C-A|YKL138C-A HSK3 SGDID:S000028421, Chr XI from 185012-184803, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segregation; is transferred to the kinetochore prior to mitosis" ORGANISM: Saccharomyces cerevisiae S288C (69 aa)
MNANKQRQYNQLAHELRELQTNLQETTKQLDIMSKQCNENLVGQLGKVHGSWLIGSYIYY
MEQMLGKTQ